PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S07592.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family G2-like
Protein Properties Length: 509aa    MW: 56161.8 Da    PI: 5.9681
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S07592.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.71.3e-33262316155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    kpr+rWtpeLH++Fveav+qLGGse+AtPk +l+lmkv++Lt++hvkSHLQkYR+
  Jcr4S07592.20 262 KPRMRWTPELHDAFVEAVNQLGGSERATPKGVLKLMKVDSLTIYHVKSHLQKYRT 316
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.031259319IPR017930Myb domain
SuperFamilySSF466893.23E-18260316IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-31261318IPR009057Homeodomain-like
TIGRFAMsTIGR015577.9E-25262316IPR006447Myb domain, plants
PfamPF002493.9E-9264315IPR001005SANT/Myb domain
PfamPF143798.9E-26368415IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MEARPTLSIQ RSVARQLNNL VVPGALSSSL PVSSLEEAYP KLSDSQQVSM EGGLKTKPLV  60
HSSQLPSNSG AVGHLFSSSA GFSSDLQYSS VSPQEKHSRN SPFISQSSKN ITALTMPQSL  120
HSGLLRSTST SHYVQEASGS WCSESLPGFL DFPVNTPVEN NQMESNSCSG VIASEEFSKR  180
NDWQEWADQL ITVDDALTPN WNELLVDTNI AEIDPKMAYQ VSKPSSNISS HQAQVCQQLP  240
APSAEIRPVL TPTSSANSAP SKPRMRWTPE LHDAFVEAVN QLGGSERATP KGVLKLMKVD  300
SLTIYHVKSH LQKYRTARYR PDSSEGSSEK KLTPLEEISS LDLKTLELHL MLEFNSKNFE  360
LELSSRGIEI TEALRLQMEV QKRLHEQLEI QRNLQLRIEE QGRYLQMMFE KQCKSGTDKL  420
KASPSTLENP SALSSDTICD SPTKNEMGAS QLDHGKTNTE TVIDKSTLEE RSRDPSGKQK  480
APQIEASENP EPDNGKSISQ SAKRPRIDA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012085253.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
RefseqXP_012085251.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
TrEMBLB9SKP00.0B9SKP0_RICCO; Transcription factor, putative
STRINGPOPTR_0002s25960.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15123498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.11e-106phosphate starvation response 1